Lineage for d5xl8c2 (5xl8 C:333-499)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (22 species)
    not a true protein
  7. 2294044Species Influenza a virus [TaxId:385590] [337345] (3 PDB entries)
  8. 2294045Domain d5xl8c2: 5xl8 C:333-499 [337346]
    Other proteins in same PDB: d5xl8a1, d5xl8b1, d5xl8c1
    automated match to d1ha0a2
    complexed with nag; mutant

Details for d5xl8c2

PDB Entry: 5xl8 (more details), 2 Å

PDB Description: the structure of hemagglutinin g228s mutant from a avian-origin h4n6 influenza virus (a/duck/czech/1956)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5xl8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl8c2 h.3.1.0 (C:333-499) automated matches {Influenza a virus [TaxId: 385590]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektndkyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrrq
lrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl8c2:

Click to download the PDB-style file with coordinates for d5xl8c2.
(The format of our PDB-style files is described here.)

Timeline for d5xl8c2:

  • d5xl8c2 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03