SCOP 1.73: Domain d1hr0k_: 1hr0 K:

Lineage for d1hr0k_ (1hr0 K:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (1 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (37 PDB entries)

8. Domain d1hr0k_: 1hr0 K: [33734]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
   complexed with mg, zn

Details for d1hr0k_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d1hr0k_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d1hr0k_:

• d1hr0k_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0k_ appears in SCOP 1.71
  
• d1hr0k_ appears in SCOP 1.75
  
• d1hr0k_ appears in the current release, SCOPe 2.08