![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (14 PDB entries) |
![]() | Domain d1hr0k_: 1hr0 K: [33734] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d1hr0k_: