Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (33 species) not a true protein |
Species Bacillus anthracis [TaxId:1392] [337333] (1 PDB entry) |
Domain d5xw3b_: 5xw3 B: [337334] automated match to d4lmaa_ |
PDB Entry: 5xw3 (more details), 2.17 Å
SCOPe Domain Sequences for d5xw3b_:
Sequence, based on SEQRES records: (download)
>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]} mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagagtg gtfmgtasylkeknidiktvivepegsilnggkagshetegiglefippflktsyfdeih tisdrnaflrvkelaqkegllvgsssgaafhaslleaekaapgtnivtifpdss
>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]} mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagafmg tasylkeknidiktvivepegfdeihtisdrnaflrvkelaqkegllvgsssgaafhasl leaekaapgtnivtifpdss
Timeline for d5xw3b_: