SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xw3b_ (5xw3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2294032Species Bacillus anthracis [TaxId:1392] [337333] (1 PDB entry)
  8. 2294033Domain d5xw3b_: 5xw3 B: [337334]
    automated match to d4lmaa_

Details for d5xw3b_

PDB Entry: 5xw3 (more details), 2.17 Å

PDB Description: crystal structure of cystathionine beta-synthase from bacillus anthracis
PDB Compounds: (B:) O-acetylserine lyase

SCOPe Domain Sequences for d5xw3b_:

Sequence, based on SEQRES records: (download)

>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl
vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq
gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagagtg
gtfmgtasylkeknidiktvivepegsilnggkagshetegiglefippflktsyfdeih
tisdrnaflrvkelaqkegllvgsssgaafhaslleaekaapgtnivtifpdss

Sequence, based on observed residues (ATOM records): (download)

>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl
vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq
gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagafmg
tasylkeknidiktvivepegfdeihtisdrnaflrvkelaqkegllvgsssgaafhasl
leaekaapgtnivtifpdss

SCOPe Domain Coordinates for d5xw3b_:

Click to download the PDB-style file with coordinates for d5xw3b_.
(The format of our PDB-style files is described here.)

Timeline for d5xw3b_:

  • d5xw3b_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from other chains:
(mouse over for more information)
d5xw3a_