Lineage for d5xw3b_ (5xw3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2294032Species Bacillus anthracis [TaxId:1392] [337333] (1 PDB entry)
  8. 2294033Domain d5xw3b_: 5xw3 B: [337334]
    automated match to d4lmaa_

Details for d5xw3b_

PDB Entry: 5xw3 (more details), 2.17 Å

PDB Description: crystal structure of cystathionine beta-synthase from bacillus anthracis
PDB Compounds: (B:) O-acetylserine lyase

SCOPe Domain Sequences for d5xw3b_:

Sequence, based on SEQRES records: (download)

>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl
vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq
gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagagtg
gtfmgtasylkeknidiktvivepegsilnggkagshetegiglefippflktsyfdeih
tisdrnaflrvkelaqkegllvgsssgaafhaslleaekaapgtnivtifpdss

Sequence, based on observed residues (ATOM records): (download)

>d5xw3b_ c.79.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
mnvyrgvhelightpiveitrfslpegvrlfaklefynpggsvkdrlgreliedalekgl
vteggtiieptagntgiglalaalqhdlrvivcvpekfsiekqelmkalgatvvhtpteq
gmtgaiakakelvneipnsyspsqfaneanprayfktlgpelwsalngeinifvagafmg
tasylkeknidiktvivepegfdeihtisdrnaflrvkelaqkegllvgsssgaafhasl
leaekaapgtnivtifpdss

SCOPe Domain Coordinates for d5xw3b_:

Click to download the PDB-style file with coordinates for d5xw3b_.
(The format of our PDB-style files is described here.)

Timeline for d5xw3b_:

  • d5xw3b_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from other chains:
(mouse over for more information)
d5xw3a_