SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wjpa1 (5wjp A:13-248)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2271465Species Pelagibacter ubique [TaxId:335992] [314766] (3 PDB entries)
  8. 2294030Domain d5wjpa1: 5wjp A:13-248 [337331]
    Other proteins in same PDB: d5wjpa2
    automated match to d3kbra_

Details for d5wjpa1

PDB Entry: 5wjp (more details), 1.57 Å

PDB Description: crystal structure of the cyclohexadienyl dehydratase-like solute- binding protein sar11_1068 from candidatus pelagibacter ubique.
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5wjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wjpa1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]}
eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl

SCOPe Domain Coordinates for d5wjpa1:

Click to download the PDB-style file with coordinates for d5wjpa1.
(The format of our PDB-style files is described here.)

Timeline for d5wjpa1:

  • d5wjpa1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5wjpa2