Lineage for d5wjpa1 (5wjp A:13-248)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2271465Species Pelagibacter ubique [TaxId:335992] [314766] (3 PDB entries)
  8. 2294030Domain d5wjpa1: 5wjp A:13-248 [337331]
    Other proteins in same PDB: d5wjpa2
    automated match to d3kbra_

Details for d5wjpa1

PDB Entry: 5wjp (more details), 1.57 Å

PDB Description: crystal structure of the cyclohexadienyl dehydratase-like solute- binding protein sar11_1068 from candidatus pelagibacter ubique.
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5wjpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wjpa1 c.94.1.0 (A:13-248) automated matches {Pelagibacter ubique [TaxId: 335992]}
eskldqilssgelkvgttgdwdpmamkdpatnkykgfdidvmqelakdmgvkitfvptew
ktivsgitagrydistsvtktpkraevagftdsyykygtvplvlkknlkkystwkslnnk
dvtiattlgtsqeekakeffplsklqsvespardfqevlagradgnitssteanklvvky
pqlaivpdgeknpaflammvskndqvwndyvnewikskkssgffnkllakynlksl

SCOPe Domain Coordinates for d5wjpa1:

Click to download the PDB-style file with coordinates for d5wjpa1.
(The format of our PDB-style files is described here.)

Timeline for d5wjpa1:

  • d5wjpa1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5wjpa2