SCOPe 2.08: Domain d5xp1b1: 5xp1 B:0-95

Lineage for d5xp1b1 (5xp1 B:0-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5xp1b1: 5xp1 B:0-95 [337323]
   Other proteins in same PDB: d5xp1a2, d5xp1b2, d5xp1c2, d5xp1d2, d5xp1e2, d5xp1f2, d5xp1g2, d5xp1h2
   automated match to d4v1db_
   mutant

Details for d5xp1b1

PDB Entry: 5xp1, 2.88 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain crystallized at ph 6

PDB Compounds: (B:) Immunoglobulin kappa variable 1D-33

SCOPe Domain Sequences for d5xp1b1:

Sequence; same for both SEQRES and ATOM records:

>d5xp1b1 b.1.1.0 (B:0-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
srfsgsgsgtdytftisslqpediatyycqqyqslp

Timeline for d5xp1b1:

• d5xp1b1 first appeared in SCOPe 2.06
  
• d5xp1b1 appears in SCOPe 2.07