Lineage for d5xdta1 (5xdt A:12-208)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2291105Species Staphylococcus aureus [TaxId:282458] [334406] (7 PDB entries)
  8. 2294019Domain d5xdta1: 5xdt A:12-208 [337320]
    Other proteins in same PDB: d5xdta2, d5xdta3
    automated match to d4m8ia1
    complexed with ca, gdp, mb3, zi7

Details for d5xdta1

PDB Entry: 5xdt (more details), 1.3 Å

PDB Description: staphylococcus aureus ftsz 12-316 complexed with txa707
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5xdta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdta1 c.32.1.1 (A:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d5xdta1:

Click to download the PDB-style file with coordinates for d5xdta1.
(The format of our PDB-style files is described here.)

Timeline for d5xdta1:

  • d5xdta1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03