SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wcfa_ (5wcf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130730Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)
  8. 2294017Domain d5wcfa_: 5wcf A: [337318]
    automated match to d4y30b_
    complexed with 144, a0s, sah

Details for d5wcfa_

PDB Entry: 5wcf (more details), 1.98 Å

PDB Description: human hmt1 hnrnp methyltransferase-like protein 6 (s. cerevisiae)
PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d5wcfa_:

Sequence, based on SEQRES records: (download)

>d5wcfa_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifcaqagarrvy
aveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygllhesmlss
vlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsclegfatrc
lmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscygsapmhgfa
iwfqvtfpggesekplvlstspfhpathwkqallylnepvqveqdtdvsgeitllpsrdn
prrlrvllrykvgdqeektkdfamed

Sequence, based on observed residues (ATOM records): (download)

>d5wcfa_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifcaqagarrvy
aveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygllhesmlss
vlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsclegfatrc
lmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscygsapmhgfa
iwfqvtfpgekplvlstspfhpathwkqallylnepvqveqdtdvsgeitllpprrlrvl
lrykvgdqeektkdfamed

SCOPe Domain Coordinates for d5wcfa_:

Click to download the PDB-style file with coordinates for d5wcfa_.
(The format of our PDB-style files is described here.)

Timeline for d5wcfa_:

  • d5wcfa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03