Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries) |
Domain d5mx2i_: 5mx2 I: [337311] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_, d5mx2v_ automated match to d4ub8i_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]} metlkitvyivvtffvllfvfgflsgdparnpk
Timeline for d5mx2i_: