Lineage for d5wi5a_ (5wi5 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178854Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2178868Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2179069Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2179070Protein automated matches [190878] (14 species)
    not a true protein
  7. 2293965Species Streptococcus pneumoniae [TaxId:170187] [337266] (1 PDB entry)
  8. 2293992Domain d5wi5a_: 5wi5 A: [337293]
    automated match to d3vcya_
    complexed with 0v5, epu, mg

Details for d5wi5a_

PDB Entry: 5wi5 (more details), 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from streptococcus pneumoniae in complex with uridine-diphosphate-2(n-acetylglucosaminyl) butyric acid, (2r)- 2-(phosphonooxy)propanoic acid and magnesium.
PDB Compounds: (A:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

SCOPe Domain Sequences for d5wi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wi5a_ d.68.2.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
ea

SCOPe Domain Coordinates for d5wi5a_:

Click to download the PDB-style file with coordinates for d5wi5a_.
(The format of our PDB-style files is described here.)

Timeline for d5wi5a_:

  • d5wi5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03