SCOPe 2.08: Domain d5hudb_: 5hud B:

Lineage for d5hudb_ (5hud B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
   Pfam PF01474

6. Protein automated matches [191084] (3 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)

8. Domain d5hudb_: 5hud B: [337292]
   Other proteins in same PDB: d5hudc2, d5hudd2
   automated match to d3kgfb_
   complexed with gol, mn, peg, pg4, pge, po4, trp, tsa

Details for d5hudb_

PDB Entry: 5hud, 2.15 Å

PDB Description: non-covalent complex of and dahp synthase and chorismate mutase from corynebacterium glutamicum with bound transition state analog

PDB Compounds: (B:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5hudb_:

Sequence; same for both SEQRES and ATOM records:

>d5hudb_ c.1.10.8 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
pegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqkladvangk
afllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyakprssd
ldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtadlyrls
ewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvdyersm
lrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitpeeava
yadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntftasng
yktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlpgryes
acdprlntqqslelaflvaemlrn

Timeline for d5hudb_:

• d5hudb_ first appeared in SCOPe 2.06
  
• d5hudb_ appears in SCOPe 2.07