SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ocla_ (5ocl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020506Species Vicugna pacos [TaxId:30538] [189756] (26 PDB entries)
  8. 2293990Domain d5ocla_: 5ocl A: [337291]
    automated match to d2p49b_

Details for d5ocla_

PDB Entry: 5ocl (more details), 2.2 Å

PDB Description: nanobody-anti-vglut nanobody complex
PDB Compounds: (A:) anti-llama nanobody

SCOPe Domain Sequences for d5ocla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocla_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
qgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtnya
dsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss

SCOPe Domain Coordinates for d5ocla_:

Click to download the PDB-style file with coordinates for d5ocla_.
(The format of our PDB-style files is described here.)

Timeline for d5ocla_:

  • d5ocla_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03