SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wi5c_ (5wi5 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178854Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2178868Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2179069Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2179070Protein automated matches [190878] (14 species)
    not a true protein
  7. 2293965Species Streptococcus pneumoniae [TaxId:170187] [337266] (1 PDB entry)
  8. 2293966Domain d5wi5c_: 5wi5 C: [337267]
    automated match to d3vcya_
    complexed with 0v5, epu, mg

Details for d5wi5c_

PDB Entry: 5wi5 (more details), 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from streptococcus pneumoniae in complex with uridine-diphosphate-2(n-acetylglucosaminyl) butyric acid, (2r)- 2-(phosphonooxy)propanoic acid and magnesium.
PDB Compounds: (C:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

SCOPe Domain Sequences for d5wi5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wi5c_ d.68.2.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mdkivvqggdnrlvgsvtiegaknavlpllaatilasegktvlqnvpilsdvfimnqvvg
glnakvdfdeeahlvkvdatgditeeapykyvskmrasivvlgpilarvghakvsmpggc
tigsrpidlhlkgleamgvkisqtagyieakaerlhgahiymdfpsvgatqnlmmaatla
dgvtvienaarepeivdlaillnemgakvkgagtetititgveklhgtthnvvqdrieag
tfmvaaamtggdvlirdavwehnrpliakllemgvevieedegirvrsqlenlkavhvkt
lphpgfptdmqaqftalmtvakgestmvetvfenrfqhleemrrmglhseiirdtarivg
gqplqgaevlstdlrasaaliltglvaqgetvvgklvhldrgyygfheklaqlgakiqri
e

SCOPe Domain Coordinates for d5wi5c_:

Click to download the PDB-style file with coordinates for d5wi5c_.
(The format of our PDB-style files is described here.)

Timeline for d5wi5c_:

  • d5wi5c_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03