SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thpo_ (5thp O:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2128914Family c.62.1.1: Integrin A (or I) domain [53301] (11 protein domains)
  6. 2129056Protein automated matches [190060] (1 species)
    not a true protein
  7. 2129057Species Human (Homo sapiens) [TaxId:9606] [186779] (13 PDB entries)
  8. 2293954Domain d5thpo_: 5thp O: [337255]
    Other proteins in same PDB: d5thpa_, d5thpb_, d5thpd_, d5thpe_, d5thpg_, d5thph_, d5thpj_, d5thpk_, d5thpm_, d5thpn_, d5thpp_, d5thpq_
    automated match to d1aoxb_
    complexed with cl, gol, mg, na, so4

Details for d5thpo_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (O:) Integrin alpha-2

SCOPe Domain Sequences for d5thpo_:

Sequence, based on SEQRES records: (download)

>d5thpo_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
lekagtlgeqif

Sequence, based on observed residues (ATOM records): (download)

>d5thpo_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqynnprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d5thpo_:

Click to download the PDB-style file with coordinates for d5thpo_.
(The format of our PDB-style files is described here.)

Timeline for d5thpo_:

  • d5thpo_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03