SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufqd_ (5ufq D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047511Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2047512Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 protein domains)
  6. 2047533Protein automated matches [190114] (2 species)
    not a true protein
  7. 2293946Species Sulfolobus solfataricus [TaxId:2287] [337247] (2 PDB entries)
  8. 2293952Domain d5ufqd_: 5ufq D: [337253]
    Other proteins in same PDB: d5ufqa_, d5ufqb_
    automated match to d1bbxc_
    complexed with ca, cd, cl, gnp, mg

Details for d5ufqd_

PDB Entry: 5ufq (more details), 2.2 Å

PDB Description: k-rasg12d(gnp)/r11.1.6 complex
PDB Compounds: (D:) r11.1.6

SCOPe Domain Sequences for d5ufqd_:

Sequence, based on SEQRES records: (download)

>d5ufqd_ b.34.13.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkfthqgeekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqmlkk
r

Sequence, based on observed residues (ATOM records): (download)

>d5ufqd_ b.34.13.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkfteekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqmlkkr

SCOPe Domain Coordinates for d5ufqd_:

Click to download the PDB-style file with coordinates for d5ufqd_.
(The format of our PDB-style files is described here.)

Timeline for d5ufqd_:

  • d5ufqd_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03