Lineage for d5ojwa_ (5ojw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164161Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries)
  8. 2293950Domain d5ojwa_: 5ojw A: [337251]
    Other proteins in same PDB: d5ojwb_
    automated match to d2gmia1

Details for d5ojwa_

PDB Entry: 5ojw (more details), 2 Å

PDB Description: s. cerevisiae ubc13 - mms2 complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 13

SCOPe Domain Sequences for d5ojwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojwa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp

SCOPe Domain Coordinates for d5ojwa_:

Click to download the PDB-style file with coordinates for d5ojwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ojwa_:

  • d5ojwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from other chains:
(mouse over for more information)
d5ojwb_