SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ojwa_ (5ojw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164161Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries)
  8. 2293950Domain d5ojwa_: 5ojw A: [337251]
    Other proteins in same PDB: d5ojwb_
    automated match to d2gmia1

Details for d5ojwa_

PDB Entry: 5ojw (more details), 2 Å

PDB Description: s. cerevisiae ubc13 - mms2 complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 13

SCOPe Domain Sequences for d5ojwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojwa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd
dypmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndp
landvaedwikneqgakakarewtklyakkkp

SCOPe Domain Coordinates for d5ojwa_:

Click to download the PDB-style file with coordinates for d5ojwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ojwa_:

  • d5ojwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from other chains:
(mouse over for more information)
d5ojwb_