Lineage for d1gcxa1 (1gcx A:1-347)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397834Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 397835Protein Exonuclease domain of family B DNA polymerases [53125] (7 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 397839Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [53131] (1 PDB entry)
    additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
  8. 397840Domain d1gcxa1: 1gcx A:1-347 [33725]
    Other proteins in same PDB: d1gcxa2

Details for d1gcxa1

PDB Entry: 1gcx (more details), 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

SCOP Domain Sequences for d1gcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcxa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Pyrococcus kodakaraensis}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

SCOP Domain Coordinates for d1gcxa1:

Click to download the PDB-style file with coordinates for d1gcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1gcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gcxa2