Lineage for d1gcxa1 (1gcx A:1-347)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72183Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 72184Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species)
  7. 72188Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [53131] (1 PDB entry)
  8. 72189Domain d1gcxa1: 1gcx A:1-347 [33725]
    Other proteins in same PDB: d1gcxa2

Details for d1gcxa1

PDB Entry: 1gcx (more details), 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

SCOP Domain Sequences for d1gcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcxa1 c.55.3.5 (A:1-347) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Archaeon Pyrococcus kodakaraensis}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

SCOP Domain Coordinates for d1gcxa1:

Click to download the PDB-style file with coordinates for d1gcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1gcxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gcxa2