Lineage for d5ufeb_ (5ufe B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047511Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2047512Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 protein domains)
  6. 2047533Protein automated matches [190114] (2 species)
    not a true protein
  7. 2293946Species Sulfolobus solfataricus [TaxId:2287] [337247] (2 PDB entries)
  8. 2293947Domain d5ufeb_: 5ufe B: [337248]
    Other proteins in same PDB: d5ufea_
    automated match to d1bbxc_
    complexed with ca, cd, cl, co, gnp, mg

Details for d5ufeb_

PDB Entry: 5ufe (more details), 2.3 Å

PDB Description: wild-type k-ras(gnp)/r11.1.6 complex
PDB Compounds: (B:) r11.1.6

SCOPe Domain Sequences for d5ufeb_:

Sequence, based on SEQRES records: (download)

>d5ufeb_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkfthqgeekqvdiskikwvirwgqyiwfkydedggakgwgyvsekdapkellqml

Sequence, based on observed residues (ATOM records): (download)

>d5ufeb_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkftgeekqvdiskikwvirwgqyiwfkydedakgwgyvsekdapkellqml

SCOPe Domain Coordinates for d5ufeb_:

Click to download the PDB-style file with coordinates for d5ufeb_.
(The format of our PDB-style files is described here.)

Timeline for d5ufeb_:

  • d5ufeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03