Lineage for d5mx2k_ (5mx2 K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631976Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2632025Family f.23.36.0: automated matches [327289] (1 protein)
    not a true family
  6. 2632026Protein automated matches [327290] (1 species)
    not a true protein
  7. 2632027Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)
  8. 2632029Domain d5mx2k_: 5mx2 K: [337245]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2k_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5mx2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2k_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lpeayaifdplvdvlpvipvlflalafvwqaavgf

SCOPe Domain Coordinates for d5mx2k_:

Click to download the PDB-style file with coordinates for d5mx2k_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2k_: