| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
| Family f.23.36.0: automated matches [327289] (1 protein) not a true family |
| Protein automated matches [327290] (1 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries) |
| Domain d5mx2k_: 5mx2 K: [337245] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d2axtk1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2k_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lpeayaifdplvdvlpvipvlflalafvwqaavgf
Timeline for d5mx2k_: