Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein automated matches [190060] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries) |
Domain d5thpi_: 5thp I: [337243] Other proteins in same PDB: d5thpa_, d5thpb_, d5thpd_, d5thpe_, d5thpg_, d5thph_, d5thpj_, d5thpk_, d5thpm_, d5thpn_, d5thpp_, d5thpq_ automated match to d1aoxb_ complexed with cl, gol, mg, na, so4 |
PDB Entry: 5thp (more details), 3.01 Å
SCOPe Domain Sequences for d5thpi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5thpi_ c.62.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} idvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyktk eemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsml kavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaalle kagtlgeqifs
Timeline for d5thpi_: