Lineage for d5ojwb_ (5ojw B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164343Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189599] (2 PDB entries)
  8. 2293940Domain d5ojwb_: 5ojw B: [337241]
    Other proteins in same PDB: d5ojwa_
    automated match to d1jatb_

Details for d5ojwb_

PDB Entry: 5ojw (more details), 2 Å

PDB Description: s. cerevisiae ubc13 - mms2 complex
PDB Compounds: (B:) Ubiquitin-conjugating enzyme variant MMS2

SCOPe Domain Sequences for d5ojwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojwb_ d.20.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriysl
sidcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkem
atpankklrqpkegetf

SCOPe Domain Coordinates for d5ojwb_:

Click to download the PDB-style file with coordinates for d5ojwb_.
(The format of our PDB-style files is described here.)

Timeline for d5ojwb_:

  • d5ojwb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from other chains:
(mouse over for more information)
d5ojwa_