Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (9 species) not a true protein |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (3 PDB entries) |
Domain d5thpg_: 5thp G: [337234] Other proteins in same PDB: d5thpc_, d5thpf_, d5thpi_, d5thpl_, d5thpo_, d5thpr_ automated match to d1v4la_ complexed with cl, gol, mg, na, so4 |
PDB Entry: 5thp (more details), 3.01 Å
SCOPe Domain Sequences for d5thpg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5thpg_ d.169.1.1 (G:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} fnclpgwsaydqhcyqafnepktwdeaerfcteqakrghlvsigsdgeadfvaqlvtnni krpelyvwiglrdrrkeqqcssewsmsasiiyvnwntgesqmcqglarwtgfrkwdysdc qaknpfvckfps
Timeline for d5thpg_: