SCOPe 2.06: Domain d5oclh_: 5ocl H:

Lineage for d5oclh_ (5ocl H:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)

8. Domain d5oclh_: 5ocl H: [337231]
   automated match to d2p49b_

Details for d5oclh_

PDB Entry: 5ocl, 2.2 Å

PDB Description: nanobody-anti-vglut nanobody complex

PDB Compounds: (H:) anti-llama nanobody

SCOPe Domain Sequences for d5oclh_:

Sequence; same for both SEQRES and ATOM records:

>d5oclh_ b.1.1.1 (H:) automated matches {Vicugna pacos [TaxId: 30538]}
qgqlvesggglvqaggslrlscaasgiifrelgidwyrqapgkqrelvasiasagmtnya
dsvkgrftisrdnakntvylqmnslkpedtavyychtlprfshlwgqgtrvtvss

Timeline for d5oclh_:

• d5oclh_ is new in SCOPe 2.06-stable
  
• d5oclh_ appears in SCOPe 2.07
  
• d5oclh_ appears in the current release, SCOPe 2.08