SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mo9x_ (5mo9 X:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (859 PDB entries)
  8. 2293929Domain d5mo9x_: 5mo9 X: [337230]
    Other proteins in same PDB: d5mo9l1
    automated match to d1wway_

Details for d5mo9x_

PDB Entry: 5mo9 (more details), 2.59 Å

PDB Description: structure of human trkb receptor ligand binding domain in complex with the fab frgment of antibody ab20
PDB Compounds: (X:) bdnf/nt-3 growth factors receptor

SCOPe Domain Sequences for d5mo9x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo9x_ b.1.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgi

SCOPe Domain Coordinates for d5mo9x_:

Click to download the PDB-style file with coordinates for d5mo9x_.
(The format of our PDB-style files is described here.)

Timeline for d5mo9x_:

  • d5mo9x_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03