| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
| Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
| Protein automated matches [191002] (3 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries) |
| Domain d5mx2j_: 5mx2 J: [337226] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d5b5ej_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
iplwivatvagmgvivivglffygayaglgssl
Timeline for d5mx2j_: