Lineage for d5mx2j_ (5mx2 J:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254789Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2254790Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2254800Protein automated matches [191002] (3 species)
    not a true protein
  7. 2254808Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (9 PDB entries)
  8. 2254815Domain d5mx2j_: 5mx2 J: [337226]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_, d5mx2v_
    automated match to d5b5ej_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2j_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5mx2j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2j_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
iplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5mx2j_:

Click to download the PDB-style file with coordinates for d5mx2j_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2j_: