SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5oclb_ (5ocl B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (132 PDB entries)
  8. 2293923Domain d5oclb_: 5ocl B: [337224]
    automated match to d5da4a_

Details for d5oclb_

PDB Entry: 5ocl (more details), 2.2 Å

PDB Description: nanobody-anti-vglut nanobody complex
PDB Compounds: (B:) anti-vglut nanobody

SCOPe Domain Sequences for d5oclb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oclb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
gpsqvqlqesggglvqagdslrlscaasgrtwsiygmgwfrqapgkerefvagitwrggn
thyadfvkgrftisrdnvkntvylqmnslkpedtavyycaanpnpsgssvyrrndywgqg
tqvtvss

SCOPe Domain Coordinates for d5oclb_:

Click to download the PDB-style file with coordinates for d5oclb_.
(The format of our PDB-style files is described here.)

Timeline for d5oclb_:

  • d5oclb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03