Lineage for d5mx2h_ (5mx2 H:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254818Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2254819Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2254833Protein automated matches [191001] (3 species)
    not a true protein
  7. 2254834Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries)
  8. 2254836Domain d5mx2h_: 5mx2 H: [337222]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_, d5mx2v_
    automated match to d2axth1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2h_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5mx2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wk

SCOPe Domain Coordinates for d5mx2h_:

Click to download the PDB-style file with coordinates for d5mx2h_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2h_: