Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein automated matches [191001] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries) |
Domain d5mx2h_: 5mx2 H: [337222] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_, d5mx2v_ automated match to d2axth1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wk
Timeline for d5mx2h_: