SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5oe0a_ (5oe0 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (39 species)
    not a true protein
  7. 2218967Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)
  8. 2293920Domain d5oe0a_: 5oe0 A: [337221]
    automated match to d1nrfa_
    complexed with cl, so4

Details for d5oe0a_

PDB Entry: 5oe0 (more details), 2.05 Å

PDB Description: crystal structure of the beta-lactamase oxa-181
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5oe0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oe0a_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiaawnrdhdlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisatqqiaflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

SCOPe Domain Coordinates for d5oe0a_:

Click to download the PDB-style file with coordinates for d5oe0a_.
(The format of our PDB-style files is described here.)

Timeline for d5oe0a_:

  • d5oe0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03