Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries) |
Domain d5ocnd_: 5ocn D: [337218] automated match to d2d2wa_ complexed with k |
PDB Entry: 5ocn (more details), 2.7 Å
SCOPe Domain Sequences for d5ocnd_:
Sequence, based on SEQRES records: (download)
>d5ocnd_ a.4.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekve nksgsssrkgclwalnpakidkmqeelqkw
>d5ocnd_ a.4.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekve kgclwalnpakidkmqeelqkw
Timeline for d5ocnd_: