Lineage for d5ocnd_ (5ocn D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984350Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)
  8. 1984379Domain d5ocnd_: 5ocn D: [337218]
    automated match to d2d2wa_
    complexed with k

Details for d5ocnd_

PDB Entry: 5ocn (more details), 2.7 Å

PDB Description: crystal structure of the forkhead domain of human foxn1
PDB Compounds: (D:) Forkhead box protein N1

SCOPe Domain Sequences for d5ocnd_:

Sequence, based on SEQRES records: (download)

>d5ocnd_ a.4.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekve
nksgsssrkgclwalnpakidkmqeelqkw

Sequence, based on observed residues (ATOM records): (download)

>d5ocnd_ a.4.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekve
kgclwalnpakidkmqeelqkw

SCOPe Domain Coordinates for d5ocnd_:

Click to download the PDB-style file with coordinates for d5ocnd_.
(The format of our PDB-style files is described here.)

Timeline for d5ocnd_: