Lineage for d5oe2a_ (5oe2 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218967Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)
  8. 2293916Domain d5oe2a_: 5oe2 A: [337217]
    automated match to d1nrfa_
    complexed with cl, na

Details for d5oe2a_

PDB Entry: 5oe2 (more details), 2.2 Å

PDB Description: crystal structure of the beta-lactamase oxa-245
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5oe2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oe2a_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqyfarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

SCOPe Domain Coordinates for d5oe2a_:

Click to download the PDB-style file with coordinates for d5oe2a_.
(The format of our PDB-style files is described here.)

Timeline for d5oe2a_:

  • d5oe2a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03