SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhve_ (5lhv E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125805Protein Uridine phosphorylase [53176] (6 species)
  7. 2126047Species Vibrio cholerae [TaxId:243277] [224899] (12 PDB entries)
  8. 2293913Domain d5lhve_: 5lhv E: [337214]
    automated match to d4k6oc_
    complexed with cl, gol, mg, na, so4, ura, uri

Details for d5lhve_

PDB Entry: 5lhv (more details), 1.29 Å

PDB Description: x-ray structure of uridine phosphorylase from vibrio cholerae in complex with uridine and sulfate ion at 1.29 a resolution
PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d5lhve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhve_ c.56.2.1 (E:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
vvveaarkmlk

SCOPe Domain Coordinates for d5lhve_:

Click to download the PDB-style file with coordinates for d5lhve_.
(The format of our PDB-style files is described here.)

Timeline for d5lhve_:

  • d5lhve_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03