SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ocng_ (5ocn G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 1983803Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)
  8. 2293912Domain d5ocng_: 5ocn G: [337213]
    automated match to d2d2wa_
    complexed with k

Details for d5ocng_

PDB Entry: 5ocn (more details), 2.7 Å

PDB Description: crystal structure of the forkhead domain of human foxn1
PDB Compounds: (G:) Forkhead box protein N1

SCOPe Domain Sequences for d5ocng_:

Sequence, based on SEQRES records: (download)

>d5ocng_ a.4.5.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekven
ksgsssrkgclwalnpakidkmqeelqkw

Sequence, based on observed residues (ATOM records): (download)

>d5ocng_ a.4.5.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekveg
clwalnpakidkmqeelqkw

SCOPe Domain Coordinates for d5ocng_:

Click to download the PDB-style file with coordinates for d5ocng_.
(The format of our PDB-style files is described here.)

Timeline for d5ocng_:

  • d5ocng_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03