SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gp4c_ (5gp4 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (119 species)
    not a true protein
  7. 2293856Species Lactobacillus brevis [TaxId:1580] [337157] (1 PDB entry)
  8. 2293907Domain d5gp4c_: 5gp4 C: [337208]
    automated match to d1xeya_
    complexed with plp

Details for d5gp4c_

PDB Entry: 5gp4 (more details), 2.16 Å

PDB Description: lactobacillus brevis cgmcc 1306 glutamate decarboxylase
PDB Compounds: (C:) Glutamate decarboxylase

SCOPe Domain Sequences for d5gp4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gp4c_ c.67.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 1580]}
etlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrlnlatfcqtymepe
avelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftgtstigsseacmla
glamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidmhvvpmdddhmsln
vdhvldyvddytigivgimgitytgqyddlarldavverynrttkfpvyihvdaasggfy
tpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpkelvfkvsylggel
ptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksltklggfslindgh
elplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrviqrivvradfgmsm
ahdfiddltqaihdldqah

SCOPe Domain Coordinates for d5gp4c_:

Click to download the PDB-style file with coordinates for d5gp4c_.
(The format of our PDB-style files is described here.)

Timeline for d5gp4c_:

  • d5gp4c_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03