Lineage for d5mo9l1 (5mo9 L:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2293905Domain d5mo9l1: 5mo9 L:1-112 [337206]
    Other proteins in same PDB: d5mo9l2, d5mo9x_
    automated match to d1t66c1

Details for d5mo9l1

PDB Entry: 5mo9 (more details), 2.59 Å

PDB Description: structure of human trkb receptor ligand binding domain in complex with the fab frgment of antibody ab20
PDB Compounds: (L:) AB20 Fab light chain

SCOPe Domain Sequences for d5mo9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo9l1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspnlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleik

SCOPe Domain Coordinates for d5mo9l1:

Click to download the PDB-style file with coordinates for d5mo9l1.
(The format of our PDB-style files is described here.)

Timeline for d5mo9l1:

  • d5mo9l1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5mo9l2
View in 3D
Domains from other chains:
(mouse over for more information)
d5mo9x_