SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mo9l1 (5mo9 L:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (155 PDB entries)
  8. 2293905Domain d5mo9l1: 5mo9 L:1-112 [337206]
    Other proteins in same PDB: d5mo9l2, d5mo9x_
    automated match to d1t66c1

Details for d5mo9l1

PDB Entry: 5mo9 (more details), 2.59 Å

PDB Description: structure of human trkb receptor ligand binding domain in complex with the fab frgment of antibody ab20
PDB Compounds: (L:) AB20 Fab light chain

SCOPe Domain Sequences for d5mo9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo9l1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspnlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleik

SCOPe Domain Coordinates for d5mo9l1:

Click to download the PDB-style file with coordinates for d5mo9l1.
(The format of our PDB-style files is described here.)

Timeline for d5mo9l1:

  • d5mo9l1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5mo9l2
View in 3D
Domains from other chains:
(mouse over for more information)
d5mo9x_