SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n26a_ (5n26 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (37 species)
    not a true protein
  7. 1990622Species Human (Homo sapiens) [TaxId:9606] [255624] (7 PDB entries)
  8. 2293903Domain d5n26a_: 5n26 A: [337204]
    automated match to d3a9qe_
    complexed with 73m, cl, cpt, mg

Details for d5n26a_

PDB Entry: 5n26 (more details), 2.05 Å

PDB Description: x-ray structure of human heavy chain ferritin in complex with cisplatin
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5n26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n26a_ a.25.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
astsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqshee
rehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklat
dkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5n26a_:

Click to download the PDB-style file with coordinates for d5n26a_.
(The format of our PDB-style files is described here.)

Timeline for d5n26a_:

  • d5n26a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03