SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5naqf_ (5naq F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2083972Species Lactobacillus plantarum [TaxId:1590] [189663] (4 PDB entries)
  8. 2293900Domain d5naqf_: 5naq F: [337201]
    automated match to d2xhya_
    complexed with po4

Details for d5naqf_

PDB Entry: 5naq (more details), 2.48 Å

PDB Description: crystal structure of native 6-phospho-glucosidase lpbgl from lactobacillus plantarum
PDB Compounds: (F:) beta-galactosidase

SCOPe Domain Sequences for d5naqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5naqf_ c.1.8.0 (F:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mvefpegfvwgaatsgpqtegnfhkqhqnvfdywfatepeqfdagvgpdtasnfyndydh
dlalmaqagvqglrtsiqwtrliddfetaslnadgvafynhvidsmlahhitpyinlhhf
dlpvalydkyhgweskhvvelfvkfaeqcfklfgdrvdhwytfnepkvvvdgqylygwhy
pqvingpkavqvaynmnlasaktvarfhelcvrpeqqigiilnltpayaasddpadlaaa
efaelwsnnlfldpavlghfpeklverltmdgvlwdatptelaiiaanpvdclgvnyyhp
frvqrpdispkslqpwmpdiyfkeydmpgrmmnvdrgweiypqamtdiarniqknygnip
wmisengmgvageerfldkqgvvqddyridfmkehltalakgiaagsncqgyfvwsgidc
wswnhayhnryglirndihtqtktlkksakwfaelgerngf

SCOPe Domain Coordinates for d5naqf_:

Click to download the PDB-style file with coordinates for d5naqf_.
(The format of our PDB-style files is described here.)

Timeline for d5naqf_:

  • d5naqf_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03