Lineage for d5ls1a1 (5ls1 A:18-223)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2191125Protein automated matches [190229] (11 species)
    not a true protein
  7. 2191138Species Human (Homo sapiens) [TaxId:9606] [187292] (123 PDB entries)
  8. 2293895Domain d5ls1a1: 5ls1 A:18-223 [337196]
    Other proteins in same PDB: d5ls1a2
    automated match to d2xjxa_
    complexed with 73z

Details for d5ls1a1

PDB Entry: 5ls1 (more details), 1.85 Å

PDB Description: crystal structure of hsp90 in complex with sar166475
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5ls1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls1a1 d.122.1.1 (A:18-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkelh
inlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgvg
fysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqtey
leerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5ls1a1:

Click to download the PDB-style file with coordinates for d5ls1a1.
(The format of our PDB-style files is described here.)

Timeline for d5ls1a1:

  • d5ls1a1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5ls1a2