SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lk9a_ (5lk9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978506Species Amphitrite ornata [TaxId:129555] [189339] (7 PDB entries)
  8. 2293890Domain d5lk9a_: 5lk9 A: [337191]
    automated match to d4kn3a_
    complexed with gol, hem, lz1, so4

Details for d5lk9a_

PDB Entry: 5lk9 (more details), 1.12 Å

PDB Description: dehaloperoxidase b from amphitrite ornata: indazole complex
PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d5lk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lk9a_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5lk9a_:

Click to download the PDB-style file with coordinates for d5lk9a_.
(The format of our PDB-style files is described here.)

Timeline for d5lk9a_:

  • d5lk9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03