Lineage for d5kmua_ (5kmu A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (43 species)
    not a true protein
  7. 2569813Species Escherichia coli [TaxId:562] [225496] (15 PDB entries)
  8. 2569824Domain d5kmua_: 5kmu A: [337189]
    automated match to d1o7eb_
    complexed with cl, peg, po4; mutant

Details for d5kmua_

PDB Entry: 5kmu (more details), 1.8 Å

PDB Description: ctx-m-9 beta lactamase mutant - t165w
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5kmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmua_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrweptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d5kmua_:

Click to download the PDB-style file with coordinates for d5kmua_.
(The format of our PDB-style files is described here.)

Timeline for d5kmua_: