Lineage for d5huda_ (5hud A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086439Protein automated matches [191084] (3 species)
    not a true protein
  7. 2293859Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)
  8. 2293887Domain d5huda_: 5hud A: [337188]
    Other proteins in same PDB: d5hudc2, d5hudd2
    automated match to d3kgfb_
    complexed with gol, mn, peg, pg4, pge, po4, trp, tsa

Details for d5huda_

PDB Entry: 5hud (more details), 2.15 Å

PDB Description: non-covalent complex of and dahp synthase and chorismate mutase from corynebacterium glutamicum with bound transition state analog
PDB Compounds: (A:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5huda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huda_ c.1.10.8 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
pegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqkladvangk
afllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyakprssd
ldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtadlyrls
ewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvdyersm
lrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitpeeava
yadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntftasng
yktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlpgryes
acdprlntqqslelaflvaemlrn

SCOPe Domain Coordinates for d5huda_:

Click to download the PDB-style file with coordinates for d5huda_.
(The format of our PDB-style files is described here.)

Timeline for d5huda_:

  • d5huda_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03