Lineage for d5ljpa_ (5ljp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102351Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2102463Protein automated matches [190443] (6 species)
    not a true protein
  7. 2293885Species Nostoc sp. [TaxId:1168] [337186] (1 PDB entry)
  8. 2293886Domain d5ljpa_: 5ljp A: [337187]
    automated match to d2v5ub_
    complexed with fmn

Details for d5ljpa_

PDB Entry: 5ljp (more details), 1.1 Å

PDB Description: e20k/i59a/e72k/i92a/d126k/a142v flavodoxin from anabaena
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d5ljpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljpa_ c.23.5.1 (A:) automated matches {Nostoc sp. [TaxId: 1168]}
kkiglfygtqtgktesvakiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnage
lqsdweglysklddvdfngklvayfgtgdqagyadnfqdaigileekisqrggktvgyws
tdgykfndskalrngkfvglvldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d5ljpa_:

Click to download the PDB-style file with coordinates for d5ljpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ljpa_:

  • d5ljpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03