SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ljpa_ (5ljp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102351Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2102463Protein automated matches [190443] (6 species)
    not a true protein
  7. 2293885Species Nostoc sp. [TaxId:1168] [337186] (1 PDB entry)
  8. 2293886Domain d5ljpa_: 5ljp A: [337187]
    automated match to d2v5ub_
    complexed with fmn

Details for d5ljpa_

PDB Entry: 5ljp (more details), 1.1 Å

PDB Description: e20k/i59a/e72k/i92a/d126k/a142v flavodoxin from anabaena
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d5ljpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljpa_ c.23.5.1 (A:) automated matches {Nostoc sp. [TaxId: 1168]}
kkiglfygtqtgktesvakiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnage
lqsdweglysklddvdfngklvayfgtgdqagyadnfqdaigileekisqrggktvgyws
tdgykfndskalrngkfvglvldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d5ljpa_:

Click to download the PDB-style file with coordinates for d5ljpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ljpa_:

  • d5ljpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03