SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ljfa_ (5ljf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2084298Species Uncultured bacterium [TaxId:77133] [188624] (10 PDB entries)
  8. 2293881Domain d5ljfa_: 5ljf A: [337182]
    automated match to d4ee9a_
    complexed with ct3

Details for d5ljfa_

PDB Entry: 5ljf (more details), 1.73 Å

PDB Description: crystal structure of the endo-1,4-glucanase rbcel1 e135a with cellotriose
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d5ljfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljfa_ c.1.8.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
svdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpsln
aelddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakr
wqghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwpry
adellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkk
ghigefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqv
allkkyaakdncsdfgpakae

SCOPe Domain Coordinates for d5ljfa_:

Click to download the PDB-style file with coordinates for d5ljfa_.
(The format of our PDB-style files is described here.)

Timeline for d5ljfa_:

  • d5ljfa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03