Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Sulfolobus islandicus [TaxId:930945] [337177] (1 PDB entry) |
Domain d5lk6d_: 5lk6 D: [337181] automated match to d3wj1a_ complexed with so4 |
PDB Entry: 5lk6 (more details), 2.6 Å
SCOPe Domain Sequences for d5lk6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lk6d_ c.69.1.0 (D:) automated matches {Sulfolobus islandicus [TaxId: 930945]} pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf yd
Timeline for d5lk6d_: