Lineage for d5lk6d_ (5lk6 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153493Species Sulfolobus islandicus [TaxId:930945] [337177] (1 PDB entry)
  8. 2153497Domain d5lk6d_: 5lk6 D: [337181]
    automated match to d3wj1a_
    complexed with so4

Details for d5lk6d_

PDB Entry: 5lk6 (more details), 2.6 Å

PDB Description: crystal structure of a lipase carboxylesterase from sulfolobus islandicus
PDB Compounds: (D:) alpha/beta hydrolase fold-3 domain protein

SCOPe Domain Sequences for d5lk6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lk6d_ c.69.1.0 (D:) automated matches {Sulfolobus islandicus [TaxId: 930945]}
pldprikellesgfivpigkasvdevrkifrqlasaapkvevgkvedikipgseaninar
vylpkangpygvliylhgggfvigdvesydplcraitnacncvvvsvdyrlapeykfpsa
vidsfdatnwvynnldkfdgkmgvaiagdsaggnlaavvallskgklnlkyqiliypavg
fdsvsrsmieysdgffltrehiewfgsqylrspadlldfrfspilaqdlsglppaliita
eydplrdqgeayanrllqagvpvtsvrfnnvihgflsffplieqgrdaisligsvlrrtf
yd

SCOPe Domain Coordinates for d5lk6d_:

Click to download the PDB-style file with coordinates for d5lk6d_.
(The format of our PDB-style files is described here.)

Timeline for d5lk6d_: