Lineage for d5lfza1 (5lfz A:42-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110502Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2110661Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2110662Protein automated matches [195982] (4 species)
    not a true protein
  7. 2110663Species Arthrobacter sp. [TaxId:1652545] [337174] (1 PDB entry)
  8. 2110664Domain d5lfza1: 5lfz A:42-240 [337175]
    Other proteins in same PDB: d5lfza2
    automated match to d2vyoa_
    complexed with ni

Details for d5lfza1

PDB Entry: 5lfz (more details), 1.56 Å

PDB Description: t48 deacetylase
PDB Compounds: (A:) chitin deacetylase

SCOPe Domain Sequences for d5lfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lfza1 c.6.2.0 (A:42-240) automated matches {Arthrobacter sp. [TaxId: 1652545]}
vdcattkcvaltfddgpgeytnrlldelseqhtpatffvlgknvkkypktlkrmvdeghq
igshtfdhkditkltaegiehevqwtdeaieqaagvkpqilrppygahgavydrlipypl
vlwdvdtldwkhhdpqktvrialeeakpgsiilmhdihessvkavpqlvsklhdagytlv
tvdqlfagtdfkpakaydh

SCOPe Domain Coordinates for d5lfza1:

Click to download the PDB-style file with coordinates for d5lfza1.
(The format of our PDB-style files is described here.)

Timeline for d5lfza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lfza2