SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lfza1 (5lfz A:42-240)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097583Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2097742Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2097743Protein automated matches [195982] (3 species)
    not a true protein
  7. 2293873Species Arthrobacter sp. [TaxId:1652545] [337174] (1 PDB entry)
  8. 2293874Domain d5lfza1: 5lfz A:42-240 [337175]
    Other proteins in same PDB: d5lfza2
    automated match to d2vyoa_
    complexed with ni

Details for d5lfza1

PDB Entry: 5lfz (more details), 1.56 Å

PDB Description: t48 deacetylase
PDB Compounds: (A:) chitin deacetylase

SCOPe Domain Sequences for d5lfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lfza1 c.6.2.0 (A:42-240) automated matches {Arthrobacter sp. [TaxId: 1652545]}
vdcattkcvaltfddgpgeytnrlldelseqhtpatffvlgknvkkypktlkrmvdeghq
igshtfdhkditkltaegiehevqwtdeaieqaagvkpqilrppygahgavydrlipypl
vlwdvdtldwkhhdpqktvrialeeakpgsiilmhdihessvkavpqlvsklhdagytlv
tvdqlfagtdfkpakaydh

SCOPe Domain Coordinates for d5lfza1:

Click to download the PDB-style file with coordinates for d5lfza1.
(The format of our PDB-style files is described here.)

Timeline for d5lfza1:

  • d5lfza1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5lfza2