Lineage for d5lk9b_ (5lk9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978506Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries)
  8. 2293871Domain d5lk9b_: 5lk9 B: [337172]
    automated match to d4kn3a_
    complexed with gol, hem, lz1, so4

Details for d5lk9b_

PDB Entry: 5lk9 (more details), 1.12 Å

PDB Description: dehaloperoxidase b from amphitrite ornata: indazole complex
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5lk9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lk9b_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5lk9b_:

Click to download the PDB-style file with coordinates for d5lk9b_.
(The format of our PDB-style files is described here.)

Timeline for d5lk9b_:

  • d5lk9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03