SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ljfb_ (5ljf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2084298Species Uncultured bacterium [TaxId:77133] [188624] (10 PDB entries)
  8. 2293870Domain d5ljfb_: 5ljf B: [337171]
    automated match to d4ee9a_
    complexed with ct3

Details for d5ljfb_

PDB Entry: 5ljf (more details), 1.73 Å

PDB Description: crystal structure of the endo-1,4-glucanase rbcel1 e135a with cellotriose
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d5ljfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljfb_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
vdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpslna
elddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakrw
qghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwprya
dellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkkg
higefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqva
llkkyaakdncsdfgpa

SCOPe Domain Coordinates for d5ljfb_:

Click to download the PDB-style file with coordinates for d5ljfb_.
(The format of our PDB-style files is described here.)

Timeline for d5ljfb_:

  • d5ljfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03