Lineage for d5ljfb_ (5ljf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2084298Species Uncultured bacterium [TaxId:77133] [188624] (10 PDB entries)
  8. 2293870Domain d5ljfb_: 5ljf B: [337171]
    automated match to d4ee9a_
    complexed with ct3

Details for d5ljfb_

PDB Entry: 5ljf (more details), 1.73 Å

PDB Description: crystal structure of the endo-1,4-glucanase rbcel1 e135a with cellotriose
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d5ljfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljfb_ c.1.8.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
vdliginvagaeftggklpgkhgthyffppegyfeywseqgihtvrfplkwerlqpslna
elddvyaslvddmldqakendikvildvhnyaryrkkvigtedvpvsayqdlmeriakrw
qghdalfaydimnapygsadklwpaaaqagidgvrkydkkrplliegaswssaarwprya
dellklkdpadnmvfsahvyidedasgsykkgpgkdfepmigvkrvepfvnwlkehgkkg
higefgipndderwldamdkllaylnencipinywaagpswgnyklsiepkdgekrpqva
llkkyaakdncsdfgpa

SCOPe Domain Coordinates for d5ljfb_:

Click to download the PDB-style file with coordinates for d5ljfb_.
(The format of our PDB-style files is described here.)

Timeline for d5ljfb_:

  • d5ljfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03